Properties:
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Peptide sequence:
MGSSHHHHHHSSGLVPRGSHMEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLNLEHHHHHH
Reconstitution conditions:
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Description:
Recombinant Human Peroxiredoxin-4 is produced by our E.coli expression system and the target gene encoding Met1-Asn271 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus.
Storage conditions:
Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Package form:
Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 8.0.
Endotoxin level:
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Protein purity:
Greater than 95% as determined by reducing SDS-PAGE.
Source:
Recombinants or rec. proteins
Shipping condition:
Dry Ice/ice packs
Origin:
Escherichia coli
Group:
recombinants
Estimated molecular weight:
33,8 kDa
UniProt number:
Q13162
Species reactivity:
Human