Properties:
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Reconstitution conditions:
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage conditions:
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Description:
Recombinant Human Peroxiredoxin-5 is produced by our Mammalian expression system and the target gene encoding Met53-Leu214 is expressed with a 6His tag at the N-terminus.
Peptide sequence:
HHHHHHMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Package form:
Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Endotoxin level:
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Protein purity:
Greater than 95% as determined by reducing SDS-PAGE.
Source:
Recombinants or rec. proteins
Shipping condition:
Ambient/Room Temperature
Group:
recombinants
Origin:
Human Cells
Estimated molecular weight:
17,9 kDa
UniProt number:
P30044
Species reactivity:
Human