Properties:
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Peptide sequence:
MGSSHHHHHHSSGLVPRGSHMSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQKLEHHHHHH
Description:
Recombinant Human Peroxiredoxin-1 is produced by our E.coli expression system and the target gene encoding Met1-Lys199 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus.
Storage conditions:
Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Package form:
Supplied as a 0.2 µm filtered solution of PBS, 10% glycerol, 0.1mM DTT,pH 6.0.
Endotoxin level:
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Reconstitution conditions:
See included datasheet or contact us for more information.
Protein purity:
Greater than 95% as determined by reducing SDS-PAGE.
Source:
Recombinants or rec. proteins
Shipping condition:
Dry ice/ice packs
Origin:
Escherichia coli
Group:
recombinants
Estimated molecular weight:
25,3 kDa
UniProt number:
Q06830
Species reactivity:
Human