Recombinant Mouse-ear cress 2-Cys peroxiredoxin BAS1, chloroplastic (BAS1)

Basic

Information

Name

Recombinant Mouse-ear cress 2-Cys peroxiredoxin BAS1, chloroplastic (BAS1)

Size

500 μg

Catalog number

RPC20398

Price

1078 EUR

Extended

Details

Test:
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Protein sequence:
KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI
Storage recommendation:
Aliquot and store at -20°C. Minimize freezing and thawing.
Notes:
For research use only. Not for diagnostic procedures.
Verified reactivity:
Arabidopsis thaliana (Mouse-ear cress)
Other name:
Thiol-specific antioxidant protein A
Source:
Recombinants or rec. proteins
Estimated production time:
7-11 business days
Latin name:
Mus musculus
Group:
recombinants
Information about sequence:
Full Length
Shipping requirements:
Blue ice
Expected molecular weight:
24.44kDa
Protein region:
66-266aa
Protein purity:
≥ 90%
Protein number:
Q96291
Use before:
1 year
Protein origin:
Yeast
Gene number:
BAS1