Peroxiredoxin 3 antibody

Basic

Information

Name

Peroxiredoxin 3 antibody

Size

50 µg

Catalog number

70R-2171

Price

475 EUR

Extended

Details

Additional Information:
This is a rabbit polyclonal antibody against PRDX3, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
Assay Information:
Peroxiredoxin 3 Blocking Peptide, catalog no. 33R-1279, is also available for use as a blocking control in assays to test for specificity of this Peroxiredoxin 3 antibody
Type of Immunogen:
Peroxiredoxin 3 antibodies were raised using the N terminal of PRDX3 corresponding to a region with amino acids AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS
Properties:
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Storage:
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Form & Buffer:
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of Peroxiredoxin 3 antibody in PBS
Specificity:
Peroxiredoxin 3 antibody was raised against the N terminal of PRDX3
Antibody Subtype:
Polyclonal Antibodies, Purified
Area of research:
Signal Transduction
Method of Purification:
Affinity purified
Category:
Primary Antibody
Usage Recommendations:
WB: 0.5 ug/ml
French translation:
anticorps
Shipping conditions:
Blue Ice
Concentration:
1 mg/ml
Raised in:
Rabbit
Cross Reactivity:
Human
Tested for:
WB